GET /api/protein/UniProt/A0A8B9R999/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B9R999",
        "id": "A0A8B9R999_ASTMX",
        "source_organism": {
            "taxId": "7994",
            "scientificName": "Astyanax mexicanus",
            "fullName": "Astyanax mexicanus (Blind cave fish)"
        },
        "name": "2-iminobutanoate/2-iminopropanoate deaminase",
        "description": [
            "Also promotes endoribonucleolytic cleavage of some transcripts by promoting recruitment of the ribonuclease P/MRP complex. Acts by bridging YTHDF2 and the ribonuclease P/MRP complex. RIDA/HRSP12 binds to N6-methyladenosine (m6A)-containing mRNAs containing a 5'-GGUUC-3' motif: cooperative binding of RIDA/HRSP12 and YTHDF2 to such transcripts lead to recruitment of the ribonuclease P/MRP complex and subsequent endoribonucleolytic cleavage",
            "Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase"
        ],
        "length": 136,
        "sequence": "MSALIRRIINTAAAPAAIGPYSQAVVVDRTMYISGQLGMDTASGQLVAGGVQAQAKQALINMGEILKAAGCGYENVVKTTVLLADMNDFNNVNEVYKQFFSRNFPARAAYQVAALPRGGLVEIEAVAVLGPITDAS",
        "proteome": null,
        "gene": "rida",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "774433ee121aa7b7f2b411cb20c3a7984fe8d122",
        "counters": {
            "domain_architectures": 89301,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 89301
        }
    }
}