GET /api/protein/UniProt/A0A8B9JMT4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B9JMT4",
        "id": "A0A8B9JMT4_ASTMX",
        "source_organism": {
            "taxId": "7994",
            "scientificName": "Astyanax mexicanus",
            "fullName": "Astyanax mexicanus (Blind cave fish)"
        },
        "name": "Elongation of very long chain fatty acids protein 5",
        "description": [
            "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. In conditions where the essential linoleic and alpha linoleic fatty acids are lacking it is also involved in the synthesis of Mead acid from oleic acid",
            "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate to the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators"
        ],
        "length": 294,
        "sequence": "MEALNLRLNTYIDSWMGPRDPRVRGWLLLDNYPPTFAFTIMYLLIVWMGPKYMNNRQPFSCRRILVVYNLALTLLSLYMFYELVTAVWQGGYNFFCQDTHSAGAADDKMIHVLWWYYFSKLIEFMDTFFFILRKNNHQITFLHVYHHATMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAIPAMRPYLWWKKYITQGQLVQFVMTMIQTSCAVVWPCGFPMGWLYFQISYMITLIIFFVNFYIKTYRSHRGLRKKDYRNGNNMSVNGHMNGTAPAETIKHRKTRAD",
        "proteome": null,
        "gene": "elovl5",
        "go_terms": [
            {
                "identifier": "GO:0009922",
                "name": "fatty acid elongase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019367",
                "name": "fatty acid elongation, saturated fatty acid",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042761",
                "name": "very long-chain fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "726b44df556ad17af08cf1eeb76a7efce6e198bf",
        "counters": {
            "domain_architectures": 25966,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25966
        }
    }
}