HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B9H9S6",
"id": "A0A8B9H9S6_ASTMX",
"source_organism": {
"taxId": "7994",
"scientificName": "Astyanax mexicanus",
"fullName": "Astyanax mexicanus (Blind cave fish)"
},
"name": "V-type proton ATPase proteolipid subunit",
"description": [
"Proton-conducting pore forming of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment"
],
"length": 147,
"sequence": "VGRSTSGQVYRWVVVQVALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSTTSDVTLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTRG",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0015078",
"name": "proton transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033177",
"name": "proton-transporting two-sector ATPase complex, proton-transporting domain",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0046961",
"name": "proton-transporting ATPase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033179",
"name": "proton-transporting V-type ATPase, V0 domain",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f21fd4232019b509ede78a3bde2eb7d31b7a54e1",
"counters": {
"domain_architectures": 15073,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 2,
"ncbifam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15073
}
}
}