GET /api/protein/UniProt/A0A8B9H6E2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B9H6E2",
"id": "A0A8B9H6E2_ASTMX",
"source_organism": {
"taxId": "7994",
"scientificName": "Astyanax mexicanus",
"fullName": "Astyanax mexicanus (Blind cave fish)"
},
"name": "Choline/ethanolaminephosphotransferase 1",
"description": [
"Catalyzes both phosphatidylcholine and phosphatidylethanolamine biosynthesis from CDP-choline and CDP-ethanolamine, respectively. Involved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. Has a higher cholinephosphotransferase activity than ethanolaminephosphotransferase activity"
],
"length": 414,
"sequence": "ANVGQAGVKGRRGVRGEQGMDSSCWLSPAVLRRLIELPAPVLSRHQLKRLEEHRYSSSGRSLLEPIMQRYWEWLVCRMPPWLAPNLITVVGLATNIFTTLVLVYYCPTATEQAPLWAYLMCAVGLFVYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTSIAVQLGTNPDWMFFCCFAGMFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMYLLAAVGGSAFWQALIPVLNIQMKIVPALCTFVGAVVSCTGYFRVIFTGGVGKNGSTIAGTSVLSPVLHIGSVIVLAMMIYKKSAIQLFEKHPCLYILAFGFVSAKITNKLVVAHMTKSEMHLHDVAFLGPGLLFLNQYFNSFIDEYVVLWIALVLSLFDLVRYCVSVCNQIASHLHIFVFKIKPPTMGAAQ",
"proteome": null,
"gene": "cept1b",
"go_terms": [
{
"identifier": "GO:0016780",
"name": "phosphotransferase activity, for other substituted phosphate groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
"counters": {
"domain_architectures": 90890,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 90890
}
}
}