GET /api/protein/UniProt/A0A8B9EIC8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B9EIC8",
"id": "A0A8B9EIC8_ANSCY",
"source_organism": {
"taxId": "8845",
"scientificName": "Anser cygnoides",
"fullName": "Anser cygnoides (Swan goose)"
},
"name": "Proenkephalin-B",
"description": [
"Dynorphin peptides differentially regulate the kappa opioid receptor. Dynorphin A(1-13) has a typical opioid activity, it is 700 times more potent than Leu-enkephalin",
"Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress",
"Leumorphin has a typical opioid activity and may have anti-apoptotic effect"
],
"length": 234,
"sequence": "MQGRMARRALVLVLCLSLAAAASADCATQCSLCASQERGTESSVRPLMCLRECQGSSPPGAEWETCRKALALLAPLVALAEGTDPSPSDAEDEEEPEQDPNPGELPLAPAKRYGGFMKKLAKGKLLSLLRENAHSKGSLSKKFGGFGRKPGERAAPEDYPGPGDVGSEEPAGTGAEGQELAELHKRYGGFMRRIRPKLKWDNQKRYGGFLRRQFKVTTRSDEDPSAYSAEVLDL",
"proteome": "UP000694521",
"gene": null,
"go_terms": [
{
"identifier": "GO:0007218",
"name": "neuropeptide signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6fa08cbd40ae6cd5bb2038f6d2313e3785d0712e",
"counters": {
"domain_architectures": 2355,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"prints": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2355
}
}
}