GET /api/protein/UniProt/A0A8B9D8W2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B9D8W2",
        "id": "A0A8B9D8W2_ANSCY",
        "source_organism": {
            "taxId": "8845",
            "scientificName": "Anser cygnoides",
            "fullName": "Anser cygnoides (Swan goose)"
        },
        "name": "N(6)-adenosine-methyltransferase non-catalytic subunit METTL14",
        "description": [
            "The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some mRNAs and regulates the circadian clock, differentiation of embryonic stem cells and cortical neurogenesis. In the heterodimer formed with mettl3, mettl14 constitutes the RNA-binding scaffold that recognizes the substrate rather than the catalytic core. N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability and processing"
        ],
        "length": 552,
        "sequence": "MPNLKYPWQNPAFAPQEKQYWERNTVQHVTELKVAVQLWCPHLLVQQLQAPLPSTNMAPATPPPRRSPIGRRGGSDARPGSRRRGAARRGAAGMNSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDDQREIAETRETCRASYDTSAPNAKRKYPDEGEADEEEIEEYKDEVELQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELISKSNTPPMYLQADLEAFDIRELKSKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIEEIAAPRSFVFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNFNAETYSSYFTTPNSHLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGERGRERNRTNFRGERGGFRGGRGGTHRGGFPTR",
        "proteome": "UP000694521",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c70b2b3d7791abce4306724393671eb9f36e946e",
        "counters": {
            "domain_architectures": 11542,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11542
        }
    }
}