HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B8YJM3",
"id": "A0A8B8YJM3_BALMU",
"source_organism": {
"taxId": "9771",
"scientificName": "Balaenoptera musculus",
"fullName": "Balaenoptera musculus (Blue whale)"
},
"name": "GTPase RhebL1",
"description": [
"Binds GTP and exhibits intrinsic GTPase activity. May activate NF-kappa-B-mediated gene transcription. Promotes signal transduction through MTOR, activates RPS6KB1, and is a downstream target of the small GTPase-activating proteins TSC1 and TSC2"
],
"length": 183,
"sequence": "MPLVRYRKVVILGYRSVGKTSLAHQFVEGEFLEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSILPYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRLPVVLVGNKADLSPDREVQAVEGKKLAESWGATFMESSARDKQLTQGIFTKVIQEIARVENSYGQERRCHLM",
"proteome": "UP000694857",
"gene": "RHEBL1",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
"counters": {
"domain_architectures": 273930,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"smart": 3,
"cathgene3d": 1,
"ncbifam": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 273930
}
}
}