HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B8SXN3",
"id": "A0A8B8SXN3_CAMFR",
"source_organism": {
"taxId": "419612",
"scientificName": "Camelus ferus",
"fullName": "Camelus ferus (Wild bactrian camel)"
},
"name": "Solute carrier family 2, facilitated glucose transporter member 8",
"description": [
"Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose. Facilitates hepatic influx of dietary trehalose, which in turn inhibits glucose and fructose influx triggering a starvation signal and hepatic autophagy through activation of AMPK and ULK1. Also able to mediate the transport of dehydroascorbate"
],
"length": 357,
"sequence": "MLLGGRLLTGLACGIASLVAPVYISEIAYPEVRGLLGSCVQLMVVIGILLAYLAGWVLEWRWLAVLGCVPPSFMLLLMCCMPETPRFLLTKHKHQEAMAAMQFLWGSEQGWEEPPVRAEHQGFRLVQLQRPGIYKPFIIGISLMAFQQLSGINAVMFYAESIFQEAKFKDSSLASVVVGVIQVLFTAIAALVMDRAGRRLLLALSGVVMVFSTSAFGAYFKLTQDGPSNSSHVELWTPVSMEPTNASMGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGVCVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLACVPETKGKTLEQITAHFEGR",
"proteome": "UP000694856",
"gene": "SLC2A8",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "03fa97b454336937c9960a7f5034cde92ca2cdaa",
"counters": {
"domain_architectures": 276159,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"prints": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 276159
}
}
}