GET /api/protein/UniProt/A0A8B8R659/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B8R659",
"id": "A0A8B8R659_CAMFR",
"source_organism": {
"taxId": "419612",
"scientificName": "Camelus ferus",
"fullName": "Camelus ferus (Wild bactrian camel)"
},
"name": "Class A basic helix-loop-helix protein 9",
"description": [
"Transcription factor, which play a role in limb development. Is an essential player in the regulatory network governing transcription of genes implicated in limb morphogenesis"
],
"length": 224,
"sequence": "MHRGASGPGLRGLKGAEGAAGDVGDSCMEAGRDFGVLRENGGPRGLGEAEEVAGSRKRSRPVRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRITALSLVLRASPAPHWPCGHLECHGQAVRAGDTGDLGSRPPPSAPPLAGPFATRCASCSLHTPLGRPRAVAEAQGLSQASAGSWRRCPGAPSAWPRSHLRAGPGLGYQHS",
"proteome": "UP000694856",
"gene": "BHLHA9",
"go_terms": [
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15b86a07eaabcbc71b6ebb705399c8a22c21f484",
"counters": {
"domain_architectures": 146351,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 146351
}
}
}