GET /api/protein/UniProt/A0A8B8IRN0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B8IRN0",
        "id": "A0A8B8IRN0_VANTA",
        "source_organism": {
            "taxId": "334116",
            "scientificName": "Vanessa tameamea",
            "fullName": "Vanessa tameamea (Kamehameha butterfly)"
        },
        "name": "Target of rapamycin complex subunit lst8",
        "description": [
            "Subunit of TORC1 and TORC2, which regulate cell growth and survival in response to nutrient and hormonal signals"
        ],
        "length": 316,
        "sequence": "MSGEGASAGAGSQVALVTGGYDHTIKLWQAHSGVCLRTMQHPDSQVNDLEISPNGQTVAACGYQHIRTYDLASANPDPVLNYEGVVKNVSRVGFQENGQWMYTGGEDCTARIWDIRIGHPFQCQRIFQVPAPVNAVVLHPDQSQIMVGGQSGIIHIWDLKTDHNEQLIPEAETSIQDIAIDPEGKMMAAVNNKGNCYVWSLGGSPPRPVPRKHLQAHKKYALRCKFSYDSTMLVTTSGDCSARVWRTSDWSLMRELRHETQRWVWDAAFTLDSRYLFTGSSDSYARLWDLEKGTLEREYCGHQKPITALAFRDQAV",
        "proteome": "UP001652626",
        "gene": "Lst8",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031929",
                "name": "TOR signaling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031931",
                "name": "TORC1 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0031932",
                "name": "TORC2 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "34247c1ee7cb3d0131cbdecf49428e6de3bf33d2",
        "counters": {
            "domain_architectures": 1369,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "profile": 2,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1369
        }
    }
}