General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B8HR04",
        "id": "A0A8B8HR04_VANTA",
        "source_organism": {
            "taxId": "334116",
            "scientificName": "Vanessa tameamea",
            "fullName": "Vanessa tameamea (Kamehameha butterfly)"
        },
        "name": "Wnt inhibitory factor 1",
        "description": [
            "Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation"
        ],
        "length": 361,
        "sequence": "MWPSASFAARVCAGVALAMSLTIGAGRRDYKDPERQNSDISLWIDERQVRMFSGISMQVFAILNGNISPYILEPNFSHKLPVIPSEVGYVNFTWRSKKRYFYNFDTLTSSDPKVLKPPYLSIKTQGRVPKASKEFSIFLPCMGNVSGVATFEIGLVLKNGRGTPLKGTPLRLNLKKECAQRGPDPECDKKCANQGWCNSDKICQCPEGYMGQHCRTALCYPQCMNGGNCTAPGVCSCPPGYQGRHCEGGICSQKCLNGGKCIQKDTCECPKGYYGRRCEFSKCVIPCLNGGKCKGVNKCRCPAGLGGNHCEVGRRAGDCARACRHGVCRAGACRCEPGWRGRFCHRTYGSSEESGEFKRPR",
        "proteome": "UP001652626",
        "gene": "LOC113394067",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "deb8b7110a94db97802a6645bce269a62df2ffed",
        "counters": {
            "domain_architectures": 39,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "profile": 2,
                "pfam": 3,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39
        }
    }
}