GET /api/protein/UniProt/A0A8B7VMD7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7VMD7",
        "id": "A0A8B7VMD7_CASCN",
        "source_organism": {
            "taxId": "51338",
            "scientificName": "Castor canadensis",
            "fullName": "Castor canadensis (American beaver)"
        },
        "name": "Keratin-associated protein 10-4-like isoform X2",
        "description": [
            "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
        ],
        "length": 263,
        "sequence": "MNMSTRSVCSDTYTDASWQVDDCPESCCEPCCAPSCCQPSCCASGCCAPASCLTFVCSPVSCVSSPCSQSVCTSCCMPSCCQQSSCEPACCASSPCQQSCCVPMCCVPVCCKPVCCVPVCSGESSSSCQQSSCEPSCCSSSPCQQYFCVPVCCKPSSSVSLLCRPVCKPACCVPDSSCCASSCQPICSRPTSSVSLFCRPVCKPACCVPVCKPACCVPDSSCCASSCQPSCCRPAVSCVSLLCSPACSRPACCGLSLGQKSSC",
        "proteome": null,
        "gene": "LOC109694970",
        "go_terms": [
            {
                "identifier": "GO:0045095",
                "name": "keratin filament",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2e155dbdd325808540b17ce977046e1f27c33f0f",
        "counters": {
            "domain_architectures": 1143,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1143
        }
    }
}