HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7V6R6",
"id": "A0A8B7V6R6_CASCN",
"source_organism": {
"taxId": "51338",
"scientificName": "Castor canadensis",
"fullName": "Castor canadensis (American beaver)"
},
"name": "Matrix metalloproteinase-23",
"description": [
"Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum"
],
"length": 392,
"sequence": "MGRGACIPCAASGAVQARWLGAVLGGLCLVPALVLLARLGTPSAPAWSAAQTDVAAPDPSGVHITQVLTPPTWLAPRRRRYTLTPTRLRWDHFNLTYRILSFPRNLLSPRETRRGLAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPVNHTDCLVSTLHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQQGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCGSWARRGFCDARQRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVSEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAQLSIIANAVNEGTYTCVVRRHQRVLTTYSWRVRVRS",
"proteome": null,
"gene": "Mmp23b",
"go_terms": [
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004222",
"name": "metalloendopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0031012",
"name": "extracellular matrix",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7db4cc7817920f3919e4b2d7386fd037dd032056",
"counters": {
"domain_architectures": 358,
"entries": 26,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 2,
"smart": 3,
"cdd": 2,
"pfam": 2,
"profile": 2,
"panther": 1,
"prints": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 358
}
}
}