GET /api/protein/UniProt/A0A8B7TI31/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7TI31",
        "id": "A0A8B7TI31_HIPAR",
        "source_organism": {
            "taxId": "186990",
            "scientificName": "Hipposideros armiger",
            "fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
        },
        "name": "Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A",
        "description": [
            "Glycosyltransferase that catalyze the transfer of GlcNAc from UDP-GlcNAc to the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans through a beta1-4 linkage and participates in the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells"
        ],
        "length": 446,
        "sequence": "MRLRNGTVATVLAFITSFLTLSWYSTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSSELSAIVQQFRRVGAETKGNKDTLNQFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLQNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVIANLEKEFSKEISSGLVEIISPPASYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQGKGIYYIQLEDDIVVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLTGKLQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPTAGDFILFKFDKPVNVERMKVWY",
        "proteome": "UP000694851",
        "gene": "MGAT4A",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "908e5caaddf5e1b91955b047cdff0e036288d8ed",
        "counters": {
            "domain_architectures": 5439,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5439
        }
    }
}