GET /api/protein/UniProt/A0A8B7TI31/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7TI31",
"id": "A0A8B7TI31_HIPAR",
"source_organism": {
"taxId": "186990",
"scientificName": "Hipposideros armiger",
"fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
},
"name": "Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A",
"description": [
"Glycosyltransferase that catalyze the transfer of GlcNAc from UDP-GlcNAc to the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans through a beta1-4 linkage and participates in the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells"
],
"length": 446,
"sequence": "MRLRNGTVATVLAFITSFLTLSWYSTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSSELSAIVQQFRRVGAETKGNKDTLNQFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLQNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVIANLEKEFSKEISSGLVEIISPPASYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQGKGIYYIQLEDDIVVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLTGKLQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPTAGDFILFKFDKPVNVERMKVWY",
"proteome": "UP000694851",
"gene": "MGAT4A",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "908e5caaddf5e1b91955b047cdff0e036288d8ed",
"counters": {
"domain_architectures": 5439,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5439
}
}
}