GET /api/protein/UniProt/A0A8B7SE31/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7SE31",
"id": "A0A8B7SE31_HIPAR",
"source_organism": {
"taxId": "186990",
"scientificName": "Hipposideros armiger",
"fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
},
"name": "VPS37 C-terminal domain-containing protein",
"description": [
"Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation"
],
"length": 354,
"sequence": "METLKDKTLEELEEMQNDPEAIDRLAQESPEVQDLQLEREMALATNRSLAERNLEFQGPLEISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESETMAEKFLEGEVPLETFLENFSTMRMLSHLRRVRVEKLQEVVRKPRASQEPAGDAAAPPCPVLPPRPLPQATPPAAEAQPPPPLQPSGVPPYPLPYSPSPGMPLGPTAQGELQPAPFPVVSQPSFPYSGPVGSPYPSAQPGPRAAAGYSWSPQRSTPPRPGYPVAPTGTPGPGYPLAGGRTPSPGYPQQSPYLSTGRKPPYPTQPQLPSFPGPPQPPYPTGPAPPYGFPPPQGPPWPRY",
"proteome": "UP000694851",
"gene": "VPS37C",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "109788746530f21004788ac02c3085a3efa61ca7",
"counters": {
"domain_architectures": 7740,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"profile": 1,
"ssf": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7740
}
}
}