GET /api/protein/UniProt/A0A8B7RZF0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7RZF0",
"id": "A0A8B7RZF0_HIPAR",
"source_organism": {
"taxId": "186990",
"scientificName": "Hipposideros armiger",
"fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
},
"name": "Serine/threonine-protein phosphatase CPPED1",
"description": [
"Protein phosphatase that dephosphorylates AKT family kinase specifically at 'Ser-473', blocking cell cycle progression and promoting cell apoptosis. May play an inhibitory role in glucose uptake by adipocytes"
],
"length": 313,
"sequence": "MSAEEAGGVFHKAQGRTLDAFSAEEEREWKGPFYFIQGADPQFGLMKAWSTGDSDSGGDEWEQEIRLMEQAIQAINKLKPKPRFFVLCGDLIHAMPGAPWRKEQTADLQRLLRRVDSEIPLVLVSGNHDVGNTPTPETIAEFQQTWGDDYFSFWVGGVLFLVLNSQFLYDASGCPALKQAQDRWLEQQLSEAGQRKCQHAVVFQHIPLFLGSIDEDDDYFNVTKAIRKELADKFIKAGIKAVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGKDTHGLRVVVVTAEKIIHRYYSLDELSERGIEDDLMDLMKKK",
"proteome": "UP000694851",
"gene": "CPPED1",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e949b0a1fe9e51299d6615c55240932f5c7152f8",
"counters": {
"domain_architectures": 234891,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 234891
}
}
}