HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7RS65",
"id": "A0A8B7RS65_HIPAR",
"source_organism": {
"taxId": "186990",
"scientificName": "Hipposideros armiger",
"fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
},
"name": "Retroviral-like aspartic protease 1",
"description": [
"Protease responsible for filaggrin processing, essential for the maintenance of a proper epidermis organization"
],
"length": 358,
"sequence": "MAGDLGTIQRQDRDQGLLGFSQSLGDEWLGIKKALQSEQATACPPLRTTVCQTTLAGPFCLPQAGHLSNTLLREALFSSVIGPALLCGFLFLAWVAAAVPEDSSGMAGSGARSQKRTFTPEPFDGANVSPQLWLHRFEVINDLNHWDHRTQLRFLKESLSGDALEVYNGLSPKDQRSYGAVKEALLKAFGGAGAAHSHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPSLWEEVTDGDLDTLRPFENVVKVANGAEMKILGIWDTVVSLGKLKLKAEFLVADASAEEAIIGTDVLQDHNAVLDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEEPSEEGRQQSK",
"proteome": "UP000694851",
"gene": "ASPRV1",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8391c96484a32768092a5939c125b951621124d3",
"counters": {
"domain_architectures": 12771,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12771
}
}
}