GET /api/protein/UniProt/A0A8B7QD06/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7QD06",
"id": "A0A8B7QD06_HIPAR",
"source_organism": {
"taxId": "186990",
"scientificName": "Hipposideros armiger",
"fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
},
"name": "Mitochondrial glutamate carrier 2",
"description": [
"Responsible for the transport of glutamate from the cytosol into the mitochondrial matrix with the concomitant import of a proton (symport system)"
],
"length": 314,
"sequence": "MSKQDLSVTAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKDIYKGMIDCLMKTVRVEGFLGMYRGAAVNLTLVTPEKAIKLAANDFFRQLLMEDGMQRDLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAHPQTSAPAPASCRPHGVGSAPAHKRPSATLIAWELLRTQGLAGLYKGLGATLLRDIPFSIVYFPLFANLNNLGFDELAGKASFAHSFMSGCAAGSIAAVTVTPLDVLKTRIQTLKKGLGEDSYTGIRDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQGVYFLGIGERILQSFE",
"proteome": "UP000694851",
"gene": "SLC25A18",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}