General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7QBE7",
        "id": "A0A8B7QBE7_HIPAR",
        "source_organism": {
            "taxId": "186990",
            "scientificName": "Hipposideros armiger",
            "fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
        },
        "name": "E2 NEDD8-conjugating enzyme",
        "description": [
            "Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. Together with the E3 ubiquitin ligase RNF7/RBX2, specifically neddylates cullin-5 (CUL5). Does not neddylate CUL1, CUL2, CUL3, CUL4A or CUL4B. Mediates neddylation of the CUL9-RBX1 complex"
        ],
        "length": 161,
        "sequence": "MYVPKEPQFADPWARQIKIGKISKLSTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVEDYIKHYAR",
        "proteome": "UP000694851",
        "gene": "UBE2F",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96b2a7d582dea26386e8f982d2fd40014d2b06f9",
        "counters": {
            "domain_architectures": 122920,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 122920
        }
    }
}