General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7Q208",
        "id": "A0A8B7Q208_HIPAR",
        "source_organism": {
            "taxId": "186990",
            "scientificName": "Hipposideros armiger",
            "fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
        },
        "name": "ATP-binding cassette sub-family B member 10, mitochondrial",
        "description": [
            "ATP-dependent transporter located in the mitochondrial inner membrane that catalyzes the export of biliverdin from the mitochondrial matrix, and plays a crucial role in hemoglobin synthesis and antioxidative stress. Participates in the early step of the heme biosynthetic process during insertion of iron into protoporphyrin IX (PPIX). Involved in the stabilization of the iron transporter mitoferrin-1/SLC25A37. In addition may be involved in mitochondrial unfolded protein response (UPRmt) signaling pathway, although ABCB10 probably does not participate in peptide export from mitochondria"
        ],
        "length": 775,
        "sequence": "MRGPAARPLRLLVRRGPVAFTWTPAARASWARLQSTGLLPPRPWSSAGLGLLGSAGAARSPRCWTSGCLGGGPGGLGGGAGLARLLGLWTRRPGACSSEVLRPGAARLPRAGLPGXGGEASRRGPAWPAAAAAAAAPKKDSRLRPAAAGRSEARKLLELAYPERRRLAAAVGFLAMSSVITMSAPFFLGRIIDVIYTDPTVDYSSNLTRLCLALSGVFLCGAAANAVRVYLMQTSGQRIVNGLRASLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQAFVGIGMMFFVSPHLATFVLSVVPPISILAVIYGRYLRKLTKITQDSLAQATQLAEERFGNIRTVRAFGKEMTEIEKYTSKMDCVMQLARKEAFARAGFFGALKTVRCRSGASQGVSQSAQAAVTKDSEHGFPGSCLKSFFANNRFSINIKASCCCSQMDGSSRGALPGSGDGCSFSPSGLSSFYSELMKGLGAGGRLWELLERKPQLPFNEGLILNEKRFQGALQFKNVHFAYPARPEVPIFRDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPISGSVHLDGQDIRQLNPVWLRSKIGTVSQEPVLFSCSIAENIAYGADNPSLVTATQVEQVADVANAAAFIRSFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLAEGRTVLVIAHRLSTVKNANLVAVLDQGRIIECGEHKELLSKPDGVYRKLMRKQSVFSVEEPLPVSRT",
        "proteome": "UP000694851",
        "gene": "ABCB10",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0140359",
                "name": "ABC-type transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "b8babab8a8a60da480131d7c384e38238b38641e",
        "counters": {
            "domain_architectures": 249078,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "cdd": 2,
                "pfam": 2,
                "smart": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 249078
        }
    }
}