General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7PKM2",
        "id": "A0A8B7PKM2_HYAAZ",
        "source_organism": {
            "taxId": "294128",
            "scientificName": "Hyalella azteca",
            "fullName": "Hyalella azteca (Amphipod)"
        },
        "name": "Carnosine N-methyltransferase",
        "description": [
            "N-methyltransferase that catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of vertebrate skeletal muscles. Also methylates other L-histidine-containing di- and tripeptides such as Gly-Gly-His, Gly-His and homocarnosine (GABA-His)"
        ],
        "length": 363,
        "sequence": "MATTNHETEQEIQEREHFQRIVNVFKSYKFLTDEWIKTKIALVKSLSPEQQLLLSDYTKHLAEMRVCVAHNAEVVQLIINDVENMFENVQHEEDGKASVKKRPILRSDLEKVYTTLRQIVRDWTAEGAAERDLCYGPILEIIDKKYPKDKIDRSCINVLVPGAGLGRLSYELANRGYACQGNEFSLFMLFASNFVLNRSSGVESLCIYPWVHSVCNVLSPDDQLRSVKFPDVNPSDLPPSSQLTMAAGDFLEIYTEADAWDCVATCFFIDCANNIVSFVQTIYNILKPGGQWINLGPLLYHYADQEGEESLEPSYDHLIAIIKKVGFVITEERTNVSSSYAQNPNSMLKTEYKSVFFVASKLS",
        "proteome": "UP000694843",
        "gene": "LOC108682124",
        "go_terms": [
            {
                "identifier": "GO:0008757",
                "name": "S-adenosylmethionine-dependent methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c57618122772362cd86aa01b920dbd77dfe428d7",
        "counters": {
            "domain_architectures": 5593,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5593
        }
    }
}