GET /api/protein/UniProt/A0A8B7PKM2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7PKM2",
"id": "A0A8B7PKM2_HYAAZ",
"source_organism": {
"taxId": "294128",
"scientificName": "Hyalella azteca",
"fullName": "Hyalella azteca (Amphipod)"
},
"name": "Carnosine N-methyltransferase",
"description": [
"N-methyltransferase that catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of vertebrate skeletal muscles. Also methylates other L-histidine-containing di- and tripeptides such as Gly-Gly-His, Gly-His and homocarnosine (GABA-His)"
],
"length": 363,
"sequence": "MATTNHETEQEIQEREHFQRIVNVFKSYKFLTDEWIKTKIALVKSLSPEQQLLLSDYTKHLAEMRVCVAHNAEVVQLIINDVENMFENVQHEEDGKASVKKRPILRSDLEKVYTTLRQIVRDWTAEGAAERDLCYGPILEIIDKKYPKDKIDRSCINVLVPGAGLGRLSYELANRGYACQGNEFSLFMLFASNFVLNRSSGVESLCIYPWVHSVCNVLSPDDQLRSVKFPDVNPSDLPPSSQLTMAAGDFLEIYTEADAWDCVATCFFIDCANNIVSFVQTIYNILKPGGQWINLGPLLYHYADQEGEESLEPSYDHLIAIIKKVGFVITEERTNVSSSYAQNPNSMLKTEYKSVFFVASKLS",
"proteome": "UP000694843",
"gene": "LOC108682124",
"go_terms": [
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c57618122772362cd86aa01b920dbd77dfe428d7",
"counters": {
"domain_architectures": 5593,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5593
}
}
}