General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7K7H1",
        "id": "A0A8B7K7H1_CAMFR",
        "source_organism": {
            "taxId": "419612",
            "scientificName": "Camelus ferus",
            "fullName": "Camelus ferus (Wild bactrian camel)"
        },
        "name": "Tapasin",
        "description": [
            "Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading)"
        ],
        "length": 449,
        "sequence": "MKPLSLLLAVALGFGTAVSAGPAVIECWLVEDAGRGQLTKKPAALLLRQGAESLLPRPDLDPELYLKVHDPAGALLAAFRRYPRDAPAPRCELSRYVPFPASANWVSVLTPEQSCPRALDGTWLMVSISSPVLSLSSLLRRESEPQLEPALITMATAVLTVLTHTPTPRIRLGEDALLDLSFAYMPPTPKAATCLAPGPPPFGLEWRRQHQGKGHLLLAATPGLNAQMPAAQEGAVAFAAWDDEEPLGPWTGNGTFWLPAVRPFQEGTYLAIVHLPYLQGQITLELAVQKPPTVSLTPAPLVWAAPGEAPPELLCLVSHFYPSDSLKVEWELRGGPEGSFQKAEGQRWLSALRHHSDGSVSLSAHLQPPPVTTRQHGARYACRVHHPSLPALGRSAEVTLQVAGLSGPSLEDGVGLFLSAFLILGLVKALGWAAAYQATSKDSTEKKTQ",
        "proteome": "UP000694856",
        "gene": "TAPBP",
        "go_terms": [
            {
                "identifier": "GO:0019885",
                "name": "antigen processing and presentation of endogenous peptide antigen via MHC class I",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f3f282032205554eabb4d86783af74dc262fec2",
        "counters": {
            "domain_architectures": 14124,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14124
        }
    }
}