GET /api/protein/UniProt/A0A8B7JFX2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7JFX2",
        "id": "A0A8B7JFX2_9AVES",
        "source_organism": {
            "taxId": "2696672",
            "scientificName": "Apteryx mantelli",
            "fullName": "Apteryx mantelli (North Island brown kiwi)"
        },
        "name": "Protein archease",
        "description": [
            "Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation"
        ],
        "length": 164,
        "sequence": "MAGDERDYNLTAEQKAIKAKYPPLEKKYEYLDHTADVQLHAWGDTLEEAFEQCVMAMFGYMTDTETVEPLDTVEVQAEGHDMLSLLFHFLDEWLYKFSANEFFIPREVKVLHIDRMQFKIRSIGWGEEFSLPKHPQGTEVKAITYSAMQICEEEKPEVFVIIDI",
        "proteome": "UP001652627",
        "gene": "ZBTB8OS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0aa81ee9ce9a63be34bb06770081b094fa6afd40",
        "counters": {
            "domain_architectures": 5269,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5269
        }
    }
}