General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7JBW5",
        "id": "A0A8B7JBW5_9AVES",
        "source_organism": {
            "taxId": "2696672",
            "scientificName": "Apteryx mantelli",
            "fullName": "Apteryx mantelli (North Island brown kiwi)"
        },
        "name": "Monoglyceride lipase",
        "description": [
            "Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth"
        ],
        "length": 311,
        "sequence": "MKTGHSSRMPEESSPKRSPLNIPYKDLPHIINADGQYLFCRYWKPAGTPRALVFIAHGAGEHCGRYDDLAQRLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKDHPGLPILILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLPNLSLGSIDPNAISRNKKEMESYTADPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPILVLHGSSDKLCDIRGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVTTSVFTEILTWVGQKVSAAGETSHT",
        "proteome": "UP001652627",
        "gene": "MGLL",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fafa3009ac3227235dfd20e7216f45a8ae4f27e5",
        "counters": {
            "domain_architectures": 104078,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 104078
        }
    }
}