GET /api/protein/UniProt/A0A8B7HYE3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7HYE3",
        "id": "A0A8B7HYE3_MICMU",
        "source_organism": {
            "taxId": "30608",
            "scientificName": "Microcebus murinus",
            "fullName": "Microcebus murinus (Gray mouse lemur)"
        },
        "name": "Golgi SNAP receptor complex member 2",
        "description": [
            "Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network"
        ],
        "length": 218,
        "sequence": "MEPLYQQTHKQVHEVQSHMGRLETADKQSLHLVENEIQASIDQIFSRLERLEILSSKEPPNKRQNAKLRVDQLKYDVQHLQTALRNFQHRRYAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTGGSCQTAHFGGKYARSSCVIWI",
        "proteome": "UP000694394",
        "gene": "GOSR2",
        "go_terms": [
            {
                "identifier": "GO:0005484",
                "name": "SNAP receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005794",
                "name": "Golgi apparatus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "babddb636d79201488190ea40b09905148916ea3",
        "counters": {
            "domain_architectures": 3773,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3773
        }
    }
}