GET /api/protein/UniProt/A0A8B7GVI9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7GVI9",
        "id": "A0A8B7GVI9_MICMU",
        "source_organism": {
            "taxId": "30608",
            "scientificName": "Microcebus murinus",
            "fullName": "Microcebus murinus (Gray mouse lemur)"
        },
        "name": "Mitochondrial adenyl nucleotide antiporter SLC25A25",
        "description": [
            "Electroneutral antiporter that most probably mediates the transport of adenyl nucleotides through the inner mitochondrial membrane. Originally identified as an ATP-magnesium/inorganic phosphate antiporter, it could have a broader specificity for adenyl nucleotides. By regulating the mitochondrial matrix adenyl nucleotide pool could adapt to changing cellular energetic demands and indirectly regulate adenyl nucleotide-dependent metabolic pathways"
        ],
        "length": 514,
        "sequence": "MVSSVLCRCVASPPPEAATAASSSASSPASVEDPCGGAVCGGPDHRLRLWSLFQTLDVNRDGGLCVNDLAVGLGRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASVEGAPQVTMSSLFRQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR",
        "proteome": "UP000694394",
        "gene": "SLC25A25",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005743",
                "name": "mitochondrial inner membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "70f879a8b3542c2ee14c96daedb06a8cc75e3ef3",
        "counters": {
            "domain_architectures": 4406,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "profile": 2,
                "smart": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "prints": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4406
        }
    }
}