HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7GVI9",
"id": "A0A8B7GVI9_MICMU",
"source_organism": {
"taxId": "30608",
"scientificName": "Microcebus murinus",
"fullName": "Microcebus murinus (Gray mouse lemur)"
},
"name": "Mitochondrial adenyl nucleotide antiporter SLC25A25",
"description": [
"Electroneutral antiporter that most probably mediates the transport of adenyl nucleotides through the inner mitochondrial membrane. Originally identified as an ATP-magnesium/inorganic phosphate antiporter, it could have a broader specificity for adenyl nucleotides. By regulating the mitochondrial matrix adenyl nucleotide pool could adapt to changing cellular energetic demands and indirectly regulate adenyl nucleotide-dependent metabolic pathways"
],
"length": 514,
"sequence": "MVSSVLCRCVASPPPEAATAASSSASSPASVEDPCGGAVCGGPDHRLRLWSLFQTLDVNRDGGLCVNDLAVGLGRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASVEGAPQVTMSSLFRQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR",
"proteome": "UP000694394",
"gene": "SLC25A25",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "70f879a8b3542c2ee14c96daedb06a8cc75e3ef3",
"counters": {
"domain_architectures": 4406,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"profile": 2,
"smart": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4406
}
}
}