GET /api/protein/UniProt/A0A8B7ANG5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7ANG5",
"id": "A0A8B7ANG5_ORYAF",
"source_organism": {
"taxId": "1230840",
"scientificName": "Orycteropus afer afer",
"fullName": "Orycteropus afer afer"
},
"name": "Protein S100-A10",
"description": [
"Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase"
],
"length": 97,
"sequence": "MPSQMEHAMETMMFTFHRFAGDKCYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLIAGLTIACNDYFVVHMKQKGKK",
"proteome": "UP000694850",
"gene": "S100A10",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
"counters": {
"domain_architectures": 10240,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10240
}
}
}