HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B7AM86",
"id": "A0A8B7AM86_ORYAF",
"source_organism": {
"taxId": "1230840",
"scientificName": "Orycteropus afer afer",
"fullName": "Orycteropus afer afer"
},
"name": "Adenylate kinase 2, mitochondrial",
"description": [
"Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways. Plays a key role in hematopoiesis"
],
"length": 241,
"sequence": "MAPNMPADEPTQECPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPMSGRSYHEEFNPPKEPMKDDITGEPLVRRSDDNEKALKIRLEAYHTQTTPLVDYYQKQGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFI",
"proteome": "UP000694850",
"gene": "AK2",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019205",
"name": "nucleobase-containing compound kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006139",
"name": "nucleobase-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004017",
"name": "AMP kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006172",
"name": "ADP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016776",
"name": "phosphotransferase activity, phosphate group as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd3ce6da6122bbe1e4b04d5ae2a462ecdf76a3f9",
"counters": {
"domain_architectures": 27793,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"hamap": 2,
"panther": 1,
"ncbifam": 3,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27793
}
}
}