GET /api/protein/UniProt/A0A8B6ZTX3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B6ZTX3",
"id": "A0A8B6ZTX3_ORYAF",
"source_organism": {
"taxId": "1230840",
"scientificName": "Orycteropus afer afer",
"fullName": "Orycteropus afer afer"
},
"name": "DnaJ homolog subfamily B member 13",
"description": [
"Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia"
],
"length": 316,
"sequence": "MGQDYYSVLKITRNSEDAQIKKAYRKLALQNHPLRSVDPASVEIFRQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTAGYVFHGNPEKVFHEFFGGDNPFSEFFDAEGSEVDLNFGGLRGRGVKKQDPSIERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFYVNSIPLGKALTCCTVEVKTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT",
"proteome": "UP000694850",
"gene": "DNAJB13",
"go_terms": [
{
"identifier": "GO:0051082",
"name": "unfolded protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b36fbaa28ca2d38c62e70de9b499db9b7e495914",
"counters": {
"domain_architectures": 29478,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 1,
"ssf": 2,
"cdd": 2,
"pfam": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29478
}
}
}