HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B6ZQE7",
"id": "A0A8B6ZQE7_ORYAF",
"source_organism": {
"taxId": "1230840",
"scientificName": "Orycteropus afer afer",
"fullName": "Orycteropus afer afer"
},
"name": "Arginine--tRNA ligase, cytoplasmic",
"description": [
"Forms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis. Modulates the secretion of AIMP1 and may be involved in generation of the inflammatory cytokine EMAP2 from AIMP1"
],
"length": 660,
"sequence": "MDGQVAQCSARLLQQEKEIKFLTAEIDRLKNCGCLEASPNLEQLKAENLKLKYRVNILRRSLQAERNRPTKNMININSRLQEVFGCAIKSAYPDLENPPLIVTPSQQPKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPSNECIEKVEIAGPGFINVHLRKDFVSEQLTNLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESMCRLFEFAGYNVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQAFYKESKKRFDTEEEFKRRAYQCVVLLQSKNPDIIKAWKLICDVSRQEFNKIYDALDISLIERGESFYQDRMNDIVKEFEDKGFVQVDDGRKIVFVPGCSVPLTIVKSDGGYTYDTSDLAAIKQRVFEEKADMIIYVVDSGQCLHFQTVFAAAQMIGWYDPKVTRVSHAGFGVVLGEDKKKFKTRSGETVRLIDLLEEGLKRSMDKLKEKERDKVLTPEELKAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEKMLQKAAQETKIILDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM",
"proteome": "UP000694850",
"gene": "RARS1",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004814",
"name": "arginine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006420",
"name": "arginyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dad10f21147cf51485dfac5a34e74a60ecbd12ad",
"counters": {
"domain_architectures": 28698,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"pfam": 3,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28698
}
}
}