General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B6ZG87",
        "id": "A0A8B6ZG87_ORYAF",
        "source_organism": {
            "taxId": "1230840",
            "scientificName": "Orycteropus afer afer",
            "fullName": "Orycteropus afer afer"
        },
        "name": "Apolipoprotein A-I",
        "description": [
            "Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility"
        ],
        "length": 263,
        "sequence": "MKAVVLTLAVLFLTGSQARHFWQQDEPQTSWSRVKDLVTVYLDALKDSSRDYVSQFEASALGKQLNLKILDNWDTLSSTFTKLQEQMRPIFQKLWEDLDKETSPLREVLNKDLEELKQKVQPYLDQFQKKWQEEVELFRQKMAPLGTELREGSRQKLQELQEKLGPLGEELRDSLRSHVDALRTQLAPYTEEMRQRLASRLEALKESNLAEYHTKASEHLSALRENAKPALEDFRQGLMPVLEGFQKSVLAALDEATKKLNSQ",
        "proteome": "UP000694850",
        "gene": "APOA1",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006869",
                "name": "lipid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042157",
                "name": "lipoprotein metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f689dbae454f053963913a5f4bb471330d88593",
        "counters": {
            "domain_architectures": 3600,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3600
        }
    }
}