GET /api/protein/UniProt/A0A8B6YE83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B6YE83",
"id": "A0A8B6YE83_CAMFR",
"source_organism": {
"taxId": "419612",
"scientificName": "Camelus ferus",
"fullName": "Camelus ferus (Wild bactrian camel)"
},
"name": "Interleukin-1 receptor-associated kinase 1-binding protein 1",
"description": [
"Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity"
],
"length": 260,
"sequence": "MSLQQAPPSRVFVELVPWTDRGRENNLVSGGETLSALRRPLSSAQAQTSSREVHVSGTAEVSASPDRAQVAVRVSSTKEAAAEAKKSVCRRLDYITQTLQQQGVQSENVTVTKDFKRVESAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISQPQFYHTSGSVENLRRQACLVAVENAWRKAQGVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSPRLSSSPTVQQKIKSATIHAASRVFVTFEVKGKEKKKKHI",
"proteome": "UP000694856",
"gene": "IRAK1BP1",
"go_terms": [
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043123",
"name": "positive regulation of canonical NF-kappaB signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b0a347e8c5f642ecae602971bb04b3ddb37e6d30",
"counters": {
"domain_architectures": 22793,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22793
}
}
}