GET /api/protein/UniProt/A0A8B6YCB1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B6YCB1",
"id": "A0A8B6YCB1_CAMFR",
"source_organism": {
"taxId": "419612",
"scientificName": "Camelus ferus",
"fullName": "Camelus ferus (Wild bactrian camel)"
},
"name": "Syntaxin-8",
"description": [
"Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER"
],
"length": 236,
"sequence": "MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERNGENTTKLTVTIRALLQKLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPELIRSSLMTGGAKRGVPNPWLFEEPEETRGLGFDEIRQQQQQIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTETRRVNLVDRKSTSCGLIMVIFLLLVAIVVVAVWPTN",
"proteome": "UP000694856",
"gene": "STX8",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "464f18d16eb2700ff3725147990c698c487d6b99",
"counters": {
"domain_architectures": 12345,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12345
}
}
}