HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B0SM74",
"id": "A0A8B0SM74_9GAMM",
"source_organism": {
"taxId": "111770",
"scientificName": "Thiothrix fructosivorans",
"fullName": "Thiothrix fructosivorans"
},
"name": "Acireductone dioxygenase",
"description": [
"Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway"
],
"length": 180,
"sequence": "MSELKIYADTNPQQAQTYTDYATISALLQEQGVRFERWEANAPLEDTATQEEVIAAYRVDIDRLMAENGFQSVDVISLTPDHPDKALFRQKFLNEHTHTEYEVRFFVDGQGLFFLHLGDKVYTVLCEKGDLISVPAGATHWFDMGANPRFKAIRLFTNTDGWVANFTGNDIAERFPRLEN",
"proteome": "UP000664466",
"gene": "mtnD",
"go_terms": [
{
"identifier": "GO:0010308",
"name": "acireductone dioxygenase (Ni2+-requiring) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010309",
"name": "acireductone dioxygenase [iron(II)-requiring] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016151",
"name": "nickel cation binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019284",
"name": "L-methionine salvage from S-adenosylmethionine",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "552e74f4cc2d23d46b226a6ad8c8614d3ba679cf",
"counters": {
"domain_architectures": 9941,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9941
}
}
}