General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8A5YPH7",
        "id": "A0A8A5YPH7_9VIRU",
        "source_organism": {
            "taxId": "12618",
            "scientificName": "Chicken anemia virus",
            "fullName": "Chicken anemia virus"
        },
        "name": "Capsid protein",
        "description": [
            "Self-assembles to form the virion icosahedral capsid with a T=1 symmetry. This very small capsid (25 nm in diameter) allows the virus to be very stable in the environment and resistant to some disinfectants, including detergents. Essential for the initial attachment to host receptors. After attachment, the virus is endocytosed and traffics to the nucleus. The capsid protein binds and transports the viral genome and Rep across the nuclear envelope"
        ],
        "length": 74,
        "sequence": "MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQG",
        "proteome": null,
        "gene": "VP1",
        "go_terms": [
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "dc1584f7e369882308df7b0a58f2bb2c8dce8f62",
        "counters": {
            "domain_architectures": 1053,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1053
        }
    }
}