GET /api/protein/UniProt/A0A8A4HIN5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8A4HIN5",
        "id": "A0A8A4HIN5_9ASPA",
        "source_organism": {
            "taxId": "53106",
            "scientificName": "Paphiopedilum parishii",
            "fullName": "Paphiopedilum parishii"
        },
        "name": "Photosystem I iron-sulfur center",
        "description": [
            "Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn"
        ],
        "length": 81,
        "sequence": "MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLSY",
        "proteome": null,
        "gene": "psaC",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009773",
                "name": "photosynthetic electron transport in photosystem I",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009522",
                "name": "photosystem I",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0042651",
                "name": "thylakoid membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "50f692799a4aac31f6710e3d85c099934fdbb2f6",
        "counters": {
            "domain_architectures": 13962,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13962
        }
    }
}