GET /api/protein/UniProt/A0A894YT83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A894YT83",
        "id": "A0A894YT83_9GEMI",
        "source_organism": {
            "taxId": "713949",
            "scientificName": "Tomato leaf curl Oman virus",
            "fullName": "Tomato leaf curl Oman virus"
        },
        "name": "Replication-associated protein",
        "description": [
            "Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities"
        ],
        "length": 354,
        "sequence": "MPRNNSFCINAKNIFLTYPKCPIPKEQMLELLKNITCPSDKLFIRVSQEKHQDGSLHIHALIQFKGKSKFRNPRHFDVTHPNTSTQFHPNFQGAKSSSDVKSYIEKDGDYIDWGQFQIDGRSARGGQQTANDAAAEALNAGSADAALTIIREKLPKDFIFQYHNLKCNLDRIFTPPVEVYVSPFSSSSFDQVPEELEEWAAENVMSSAARPWRPNSIIIEGDSRTGKTMWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYLKHFKEFMGAQRDWQSNTKYGKPIQIKGGIPTIFLCNPGPTSSYREYLDEEKNISLKNWALKNATFVTLYEPLFSSANQNPTPHSED",
        "proteome": null,
        "gene": "C1",
        "go_terms": [
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016888",
                "name": "DNA endonuclease activity, producing 5'-phosphomonoesters",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "3576995e52844acc3074eed64c2fbc93b5358a47",
        "counters": {
            "domain_architectures": 9115,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "profile": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9115
        }
    }
}