GET /api/protein/UniProt/A0A859CVY4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A859CVY4",
        "id": "A0A859CVY4_9GAMM",
        "source_organism": {
            "taxId": "178399",
            "scientificName": "Marinomonas primoryensis",
            "fullName": "Marinomonas primoryensis"
        },
        "name": "UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase",
        "description": [
            "Catalyzes the addition of meso-diaminopimelic acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial cell-wall peptidoglycan"
        ],
        "length": 488,
        "sequence": "MAQLTHIQLLNLAGYSSGSSSHSAIYTHVETDGRKADPQCVFFALPGVATNGWDYLDSVISLGCKVAVVPTGLCLKRDDIELISVDNPTELLVACLHSYFGHMPKHIVAVTGTNGKSSICYYIAQLAQFIGLNSGLVGTFGIGPLNDLSEAKQTTPDILSLHLTLMAMAGSGVGLVAFEASSHALDQGRVDGVPFQTAVFSNLSRDHLDYHGDMTAYASAKQRLFAFKSVSNSIFCLDDSYAHFMAEAAEGSSCHYYSEQNSRADFYVKNLILEPSGCRFILCHPEGEGVVFLPLLGRFNVQNALAALASMWSIADDKSALVRGLSALRGAPGRMDKVQELNAPLIVVDFAHTSEALKVALQALKEHCSGRLICVFGCGGDRDRGKRPLMMAAALQNADYVWLTSDNPRTESIEQIFLDALAQTYDDELFSVEPDRRVAIANAILSATPNDVVLIAGKGHESYQDIQGIKHHFDDKEEALKAVKSYVN",
        "proteome": null,
        "gene": "murE",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016881",
                "name": "acid-amino acid ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008360",
                "name": "regulation of cell shape",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051301",
                "name": "cell division",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e6ab2b5b1f832ff43dbb14fcfeb9fea358486a52",
        "counters": {
            "domain_architectures": 37786,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 37786
        }
    }
}