GET /api/protein/UniProt/A0A857JFK3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A857JFK3",
"id": "A0A857JFK3_9BURK",
"source_organism": {
"taxId": "2697032",
"scientificName": "Xylophilus rhododendri",
"fullName": "Xylophilus rhododendri"
},
"name": "Negative regulator of flagellin synthesis",
"description": [
"Responsible for the coupling of flagellin expression to flagellar assembly by preventing expression of the flagellin genes when a component of the middle class of proteins is defective. It negatively regulates flagellar genes by inhibiting the activity of FliA by directly binding to FliA"
],
"length": 111,
"sequence": "MKIGQTPDIPEIATPVAKTAAVASSAAATAAKTAATTTPDPAAVKQSGVSVTVSSLTRSLETSSASGSFDAEKVSKMKEAIANGTFTVDAEAIADKLLSNAQQVLRKGQVG",
"proteome": "UP000464787",
"gene": "flgM",
"go_terms": [
{
"identifier": "GO:0045892",
"name": "negative regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f1674cf6f70d6b376bb3587a0ee9057d80ec7fd1",
"counters": {
"domain_architectures": 9361,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9361
}
}
}