General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A857JBQ2",
        "id": "A0A857JBQ2_9BURK",
        "source_organism": {
            "taxId": "2697032",
            "scientificName": "Xylophilus rhododendri",
            "fullName": "Xylophilus rhododendri"
        },
        "name": "Segregation and condensation protein A",
        "description": [
            "Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpB that pull DNA away from mid-cell into both cell halves"
        ],
        "length": 280,
        "sequence": "MNDIASVEADGHGHGDSPDVIDQVALARLYGEPLFAMPQDLYIPPDALEVFLEAFEGPLDLLLYLIRKQNFNILDIPMAALTRQYLSYVDEIRSRNLELAAEYLLMAAMLIEIKSRMLLPPKAAVPGAEPEDPRAELVRRLLEYEQMKLAAAKLNALPQYGRDFLRAQVTIEQSLQPRFPDVHVADLQSAWRDILQRARLVQHHTITREELSVREYMSYVLRSLQGRRFVPFEELFQPEKGQTVLVVTFIALLELAKETLIEITQAEAFAPIYVRLAYSS",
        "proteome": "UP000464787",
        "gene": "scpA",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "947ef93f9e9aeec272101fe5422f90713882cd63",
        "counters": {
            "domain_architectures": 20392,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20392
        }
    }
}