GET /api/protein/UniProt/A0A857J618/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A857J618",
        "id": "A0A857J618_9BURK",
        "source_organism": {
            "taxId": "2697032",
            "scientificName": "Xylophilus rhododendri",
            "fullName": "Xylophilus rhododendri"
        },
        "name": "Glycine cleavage system H protein",
        "description": [
            "The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein"
        ],
        "length": 124,
        "sequence": "MTVKFSREHQWIDSSDTSAARVGITPFAQDTLGDIVFVDLPAVGKRFAQGEVAAVVESVKTAADVFMPAAGEIVAINEALRDDPALANTDPLGAAWFFTVKLSDPAELDGLLDAAAYEAFSKDA",
        "proteome": "UP000464787",
        "gene": "gcvH",
        "go_terms": [
            {
                "identifier": "GO:0019464",
                "name": "glycine decarboxylation via glycine cleavage system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005960",
                "name": "glycine cleavage complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "676356c2fef36c74096b9603921b62087f9f9212",
        "counters": {
            "domain_architectures": 32373,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "profile": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32373
        }
    }
}