GET /api/protein/UniProt/A0A857J618/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A857J618",
"id": "A0A857J618_9BURK",
"source_organism": {
"taxId": "2697032",
"scientificName": "Xylophilus rhododendri",
"fullName": "Xylophilus rhododendri"
},
"name": "Glycine cleavage system H protein",
"description": [
"The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein"
],
"length": 124,
"sequence": "MTVKFSREHQWIDSSDTSAARVGITPFAQDTLGDIVFVDLPAVGKRFAQGEVAAVVESVKTAADVFMPAAGEIVAINEALRDDPALANTDPLGAAWFFTVKLSDPAELDGLLDAAAYEAFSKDA",
"proteome": "UP000464787",
"gene": "gcvH",
"go_terms": [
{
"identifier": "GO:0019464",
"name": "glycine decarboxylation via glycine cleavage system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005960",
"name": "glycine cleavage complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "676356c2fef36c74096b9603921b62087f9f9212",
"counters": {
"domain_architectures": 32373,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"profile": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32373
}
}
}