General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A852DTV5",
        "id": "A0A852DTV5_VIDMA",
        "source_organism": {
            "taxId": "187451",
            "scientificName": "Vidua macroura",
            "fullName": "Vidua macroura (Pin-tailed whydah)"
        },
        "name": "Proteasome assembly chaperone 2",
        "description": [
            "Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization"
        ],
        "length": 256,
        "sequence": "GSAAPDFQGFTLLMPAVSVGNVGQLAIDLVISTLDMAKVGYFYTDCLVPMVGNNPYATAEENSVELSINAEVYSLPSKKLVVLQIRSPFIKNKYRPFCETLLSWVKSSKCARVVLLSSSHAYQRDDEQLLGTPLRYLLTPDLEKAVGGRMKELNWKEMEKVAAYPGINNTDKVLHIPGGGITKLLFTESCSEGIQMAVLLKFCSEGDNIPDAFVLVNYLNEWLQLIKSEVSTVSSKWKIPSSWRLLFGNGLPPALF",
        "proteome": "UP000656497",
        "gene": "Psmg2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "00f2c94e7f014129226e98541d5adb7e5d14e940",
        "counters": {
            "domain_architectures": 13899,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13899
        }
    }
}