General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A851LL88",
        "id": "A0A851LL88_CORCR",
        "source_organism": {
            "taxId": "103954",
            "scientificName": "Corythaeola cristata",
            "fullName": "Corythaeola cristata (Great blue turaco)"
        },
        "name": "Choline/ethanolaminephosphotransferase 1",
        "description": [
            "Catalyzes both phosphatidylcholine and phosphatidylethanolamine biosynthesis from CDP-choline and CDP-ethanolamine, respectively. Involved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. Has a higher cholinephosphotransferase activity than ethanolaminephosphotransferase activity"
        ],
        "length": 168,
        "sequence": "PLSKHQLKRLEEHKYQSAGRSLLEPLMQGYWEWLVGRVPAWIAPNLITIIGLLINIFTTLLLVYYCPTATEQAPPWAYIACACGLFIYQSLDAIDGKQARRTNSSTPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPDWMFFCCFAGTFMFYCAHWQTYVSGTLRFG",
        "proteome": "UP000621168",
        "gene": "Cept1",
        "go_terms": [
            {
                "identifier": "GO:0016780",
                "name": "phosphotransferase activity, for other substituted phosphate groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
        "counters": {
            "domain_architectures": 90890,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 90890
        }
    }
}