HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A844FB70",
"id": "A0A844FB70_CLOSV",
"source_organism": {
"taxId": "29347",
"scientificName": "Clostridium scindens (strain JCM 10418 / VPI 12708)",
"fullName": "Clostridium scindens (strain JCM 10418 / VPI 12708)"
},
"name": "1-deoxy-D-xylulose 5-phosphate reductoisomerase",
"description": [
"Catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP)"
],
"length": 380,
"sequence": "MKRIAILGSTGSIGTQTLEVVRENGDIEVLGLAAGSNITLLEEQIRQFHPRLAAVWSEEKAIELRTRIADTDTKVVSGMDGLIEVSILKDTEILVTAIVGMIGIRPTIEAIKAGKDIALANKETLVTAGHIIMPLAAEKNVSILPVDSEHSAIFQSLQGNEHKAIHKILLTASGGPFRGRTEEELLDIKVEDALKHPNWSMGQKITIDSSTMVNKGLEVIEAKWLFQVDVDQVQVIVQPQSIIHSMVEYVDGAIMAELGTPDMKLPIQYALYYPHRRYLPGERLDFYSLGRLEFEKPDMRTFYGLALAYEAGRAGGTLPTVFNAANELAVSQFLNRQIKYLEIMEIIEDCMQAHKNIENPTLQQILDTEAATYERINSRR",
"proteome": null,
"gene": "dxr",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030604",
"name": "1-deoxy-D-xylulose-5-phosphate reductoisomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070402",
"name": "NADPH binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a33d1c0504d8e2272db36c9e1c291c482c2181df",
"counters": {
"domain_architectures": 22231,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 3,
"pfam": 3,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 22231
}
}
}