GET /api/protein/UniProt/A0A844FB70/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A844FB70",
        "id": "A0A844FB70_CLOSV",
        "source_organism": {
            "taxId": "29347",
            "scientificName": "Clostridium scindens (strain JCM 10418 / VPI 12708)",
            "fullName": "Clostridium scindens (strain JCM 10418 / VPI 12708)"
        },
        "name": "1-deoxy-D-xylulose 5-phosphate reductoisomerase",
        "description": [
            "Catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP)"
        ],
        "length": 380,
        "sequence": "MKRIAILGSTGSIGTQTLEVVRENGDIEVLGLAAGSNITLLEEQIRQFHPRLAAVWSEEKAIELRTRIADTDTKVVSGMDGLIEVSILKDTEILVTAIVGMIGIRPTIEAIKAGKDIALANKETLVTAGHIIMPLAAEKNVSILPVDSEHSAIFQSLQGNEHKAIHKILLTASGGPFRGRTEEELLDIKVEDALKHPNWSMGQKITIDSSTMVNKGLEVIEAKWLFQVDVDQVQVIVQPQSIIHSMVEYVDGAIMAELGTPDMKLPIQYALYYPHRRYLPGERLDFYSLGRLEFEKPDMRTFYGLALAYEAGRAGGTLPTVFNAANELAVSQFLNRQIKYLEIMEIIEDCMQAHKNIENPTLQQILDTEAATYERINSRR",
        "proteome": null,
        "gene": "dxr",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030604",
                "name": "1-deoxy-D-xylulose-5-phosphate reductoisomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070402",
                "name": "NADPH binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a33d1c0504d8e2272db36c9e1c291c482c2181df",
        "counters": {
            "domain_architectures": 22231,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 3,
                "pfam": 3,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 22231
        }
    }
}