GET /api/protein/UniProt/A0A842CJX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A842CJX1",
        "id": "A0A842CJX1_9LIST",
        "source_organism": {
            "taxId": "529731",
            "scientificName": "Listeria marthii",
            "fullName": "Listeria marthii"
        },
        "name": "Signal recognition particle receptor FtsY",
        "description": [
            "Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC)"
        ],
        "length": 328,
        "sequence": "MTFFKKLKDKITQQTDSVSGKFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVDVIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMVDNEK",
        "proteome": null,
        "gene": "ftsY",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f314f88e96f5face42ce1f6d3cd28912b5731c32",
        "counters": {
            "domain_architectures": 27006,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 3,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27006
        }
    }
}