GET /api/protein/UniProt/A0A842CJX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A842CJX1",
"id": "A0A842CJX1_9LIST",
"source_organism": {
"taxId": "529731",
"scientificName": "Listeria marthii",
"fullName": "Listeria marthii"
},
"name": "Signal recognition particle receptor FtsY",
"description": [
"Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC)"
],
"length": 328,
"sequence": "MTFFKKLKDKITQQTDSVSGKFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVDVIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMVDNEK",
"proteome": null,
"gene": "ftsY",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006614",
"name": "SRP-dependent cotranslational protein targeting to membrane",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f314f88e96f5face42ce1f6d3cd28912b5731c32",
"counters": {
"domain_architectures": 27006,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"smart": 3,
"pfam": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 27006
}
}
}