GET /api/protein/UniProt/A0A840EEZ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A840EEZ3",
"id": "A0A840EEZ3_9BACT",
"source_organism": {
"taxId": "146919",
"scientificName": "Salinibacter ruber",
"fullName": "Salinibacter ruber"
},
"name": "Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C",
"description": [
"Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)"
],
"length": 95,
"sequence": "MSVTRDDVRHVAQLARLDFSEEEEARMAEELSEILGYVEKLDELDTAGVPPMSHVLDVTNVFRSDEIEERIDRGQALEPAPDADNEHFLVPQVVE",
"proteome": null,
"gene": "gatC",
"go_terms": [
{
"identifier": "GO:0006450",
"name": "regulation of translational fidelity",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "18250786e3cb6183ae4d86d62ad3d105c32ab112",
"counters": {
"domain_architectures": 22404,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 22404
}
}
}