General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A839A2M5",
        "id": "A0A839A2M5_9LACT",
        "source_organism": {
            "taxId": "2748684",
            "scientificName": "Ruoffia halotolerans",
            "fullName": "Ruoffia halotolerans"
        },
        "name": "Probable glycine dehydrogenase (decarboxylating) subunit 2",
        "description": [
            "The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein"
        ],
        "length": 490,
        "sequence": "MLKEYNELIFEISQPGHVSYDLPENDVPTYDLTKDLPEYLNRQEVAKLPEVSELQLVRHYTALSNKNFGIESGPYPLGSCTMKYNPKVNETIAALDGFSQIHPQQEPETAQGALELLYNLQEYLAEITGMDHISLQPAAGAHGELAAILMFKAFHEVNGEGVQRKNIIVPDSAHGTNPATATVAGYETIEIPSTKEGIIDIEALKQVVNEKTAGIMLTNPNTAGLYERDIQQIVDIVHQVGGLAYYDGANSNAIMGMSNPGTMGFDAVHLNLHKTFTGPHGGGGPGSGPIGVKANLEAFLPVPRIEKVDEHYVINSDYPQSIGRIKGNFGNFGVNVRAYSYIRTMGADGLTQVSKDAVLNSNYLKARIKEYYDVPFAQHCMHEFVVSCKRQKVEHNVNAKDIGKRLLDYGIHSPTTYFPLIVEECLMIEPTETESIRELDQIADAFISISKEIMEDPEMVKQAPHLTSVRRLDETTAARKPVLTYQASLQ",
        "proteome": "UP000571018",
        "gene": "gcvPB",
        "go_terms": [
            {
                "identifier": "GO:0004375",
                "name": "glycine dehydrogenase (decarboxylating) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019464",
                "name": "glycine decarboxylation via glycine cleavage system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006546",
                "name": "glycine catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1af63f59835630cc23ab665db7dd40eb143df968",
        "counters": {
            "domain_architectures": 4440,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 2,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4440
        }
    }
}