GET /api/protein/UniProt/A0A833UHY3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A833UHY3",
"id": "A0A833UHY3_JUGRE",
"source_organism": {
"taxId": "51240",
"scientificName": "Juglans regia",
"fullName": "Juglans regia (English walnut)"
},
"name": "ubiquitinyl hydrolase 1",
"description": [
"Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Required for the correct development of pollen"
],
"length": 374,
"sequence": "MGAAGSKLERAFGDQFPEGERYFGLENFGNTAYCNCVLQALYFCVPFREQLLEYYANNKNIGDAEENLLTCLADLFTQISSQKKKTGVIAPKRFVQRLKKQNEVFRSYMAQDAHEFLNFLLNELVDILEKDSQAAKSDPEASSPSDKAANGPKNVQANGPQKDPLVTWMHKIFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRYEYIEQLGRYKKLSYRVVFPLELKLSNTMEDADSEYSLFAVVVHIGSGSNHGHYVCLVKSRNHWLFFDDENVEMIDESVVQTFFGSSHEYSSNTDLAYILFYESLGNDNKN",
"proteome": null,
"gene": "F2P56_022218",
"go_terms": [
{
"identifier": "GO:0004843",
"name": "cysteine-type deubiquitinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016579",
"name": "protein deubiquitination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "287d9882593b6f934350f045dae1095ecd87c2a3",
"counters": {
"domain_architectures": 67723,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 67723
}
}
}