HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A833RXM6",
"id": "A0A833RXM6_9HYME",
"source_organism": {
"taxId": "561572",
"scientificName": "Frieseomelitta varia",
"fullName": "Frieseomelitta varia"
},
"name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process"
],
"length": 210,
"sequence": "MDDEAETYKLWRIRKTVMQLCHDRGYLVTQDELDQTLEQFKEQFGDKPSEKRPARSDLIVLVAHNDDPTDQLFVFFPDEPKIGIKTIKTYCQRMQEEKIHRAIIVVQQGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHIVLTPDEKEELLTRYKLKENQLMRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYISYRLVC",
"proteome": "UP000655588",
"gene": "E2986_08309",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c0a9d2b48fda2a81d303b143564192a82911114d",
"counters": {
"domain_architectures": 5571,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5571
}
}
}