HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A832TIT6",
"id": "A0A832TIT6_9CREN",
"source_organism": {
"taxId": "111955",
"scientificName": "Sulfurisphaera tokodaii",
"fullName": "Sulfurisphaera tokodaii"
},
"name": "Tryptophan synthase beta chain",
"description": [
"The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine"
],
"length": 431,
"sequence": "MLEKVRFDLPQDEIPTEWYNILPDLPEPLPEPQDPTGKSFEILKQVLPSKVLELEFSKERYIKIPEEVLQRYLQVGRPTPIIRARKLEEYLGGYIKIYMKMESHTYTGSHKINSALAHVYFAKLDNAKFVSTETGAGQWGSAVALASALFNIQAHIFMVRTSYYAKPYRRYLMQMYNAQVHPSPSEFTRYGREVLAKDPNTPGSLGIAISEAVYYALENGGKYVVGSVVNSDILFKTIAGMEAKKQMEMIGEDPDYIIGVVGGGSNYAALAYPFLGEELRKGKVRRKYIASGAIEVPKMTKGVYKYDYPDTAKILPMLKMYTIGSDFIPAPVYAGGLRYHAVAPTLSLLMYKGIVQARDYSQEEAFSWAKLFSQIEGWVPAPETSHALPILKEIVEEAKKSGEKKTVLISFSGHGLLDLANYADVLGFNKE",
"proteome": null,
"gene": "trpB",
"go_terms": [
{
"identifier": "GO:0004834",
"name": "tryptophan synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000162",
"name": "L-tryptophan biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006568",
"name": "L-tryptophan metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
"counters": {
"domain_architectures": 181949,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 2,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 181949
}
}
}